Lineage for d3vk2c_ (3vk2 C:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2471297Family c.67.1.3: Cystathionine synthase-like [53402] (17 protein domains)
  6. 2471448Protein Methionine gamma-lyase, MGL [64126] (4 species)
  7. 2471459Species Pseudomonas putida [TaxId:303] [75271] (13 PDB entries)
    Uniprot P13254
  8. 2471490Domain d3vk2c_: 3vk2 C: [194668]
    automated match to d1ukja_
    complexed with so4; mutant

Details for d3vk2c_

PDB Entry: 3vk2 (more details), 2.3 Å

PDB Description: Crystal Structure of L-Methionine gamma-Lyase from Pseudomonas putida C116H Mutant.
PDB Compounds: (C:) methionine gamma-lyase

SCOPe Domain Sequences for d3vk2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vk2c_ c.67.1.3 (C:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]}
lpgfatraihhgydpqdhggalvppvyqtatftfptveygaacfageqaghfysrisnpt
lnllearmasleggeaglalasgmgaitstlwtllrpgdevllgntlyghtfaflhhgig
efgvklrhvdmadlqaleaamtpatrviyfespanpnmhmadiagvakiarkhgatvvvd
ntyctpylqrplelgadlvvhsatkylsghgditagivvgsqalvdrirlqglkdmtgav
lsphdaallmrgiktlnlrmdrhcanaqvlaeflarqpqvelihypglasfpqytlarqq
msqpggmiafelkggigagrrfmnalqlfsravslgdaeslaqhpasmthssytpeerah
ygiseglvrlsvglediddlladvqqalkasa

SCOPe Domain Coordinates for d3vk2c_:

Click to download the PDB-style file with coordinates for d3vk2c_.
(The format of our PDB-style files is described here.)

Timeline for d3vk2c_: