SCOPe 2.06: Domain d3zzca_: 3zzc A:

Lineage for d3zzca_ (3zzc A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (19 species)
   not a true protein

7. Species Human coxsackievirus [TaxId:12072] [188739] (11 PDB entries)

8. Domain d3zzca_: 3zzc A: [194663]
   automated match to d2vb0a_
   complexed with g83; mutant

Details for d3zzca_

PDB Entry: 3zzc, 2.1 Å

PDB Description: crystal structure of 3c protease mutant (t68a and n126y) of coxsackievirus b3 complexed with alpha, beta-unsaturated ethyl ester inhibitor 83

PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d3zzca_:

Sequence; same for both SEQRES and ATOM records:

>d3zzca_ b.47.1.4 (A:) automated matches {Human coxsackievirus [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdganleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflylggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn

Timeline for d3zzca_:

• d3zzca_ first appeared in SCOPe 2.02
  
• d3zzca_ appears in SCOPe 2.05
  
• d3zzca_ appears in SCOPe 2.07
  
• d3zzca_ appears in the current release, SCOPe 2.08