Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins) |
Protein automated matches [190384] (12 species) not a true protein |
Species Human coxsackievirus [TaxId:12072] [188739] (4 PDB entries) |
Domain d3zzca_: 3zzc A: [194663] automated match to d2vb0a_ complexed with g83; mutant |
PDB Entry: 3zzc (more details), 2.1 Å
SCOPe Domain Sequences for d3zzca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zzca_ b.47.1.4 (A:) automated matches {Human coxsackievirus [TaxId: 12072]} gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak elvdkdganleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt eygflylggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn
Timeline for d3zzca_: