SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3zz4a1 (3zz4 A:1-180)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2058054Protein automated matches [190384] (19 species)
    not a true protein
  7. 2058080Species Human coxsackievirus [TaxId:12072] [188739] (11 PDB entries)
  8. 2058091Domain d3zz4a1: 3zz4 A:1-180 [194659]
    Other proteins in same PDB: d3zz4a2, d3zz4b2
    automated match to d2vb0a_
    mutant

Details for d3zz4a1

PDB Entry: 3zz4 (more details), 2.1 Å

PDB Description: Crystal structure of 3C protease mutant (T68A and N126Y) of coxsackievirus B3
PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d3zz4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zz4a1 b.47.1.4 (A:1-180) automated matches {Human coxsackievirus [TaxId: 12072]}
gpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvldak
elvdkdganleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqvt
eygflylggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyfn

SCOPe Domain Coordinates for d3zz4a1:

Click to download the PDB-style file with coordinates for d3zz4a1.
(The format of our PDB-style files is described here.)

Timeline for d3zz4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3zz4a2