SCOPe 2.05: Domain d3zzaa_: 3zza A:

Lineage for d3zzaa_ (3zza A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein automated matches [190384] (12 species)
   not a true protein

7. Species Human coxsackievirus [TaxId:12072] [188739] (11 PDB entries)

8. Domain d3zzaa_: 3zza A: [194657]
   automated match to d2vb0a_
   complexed with g84

Details for d3zzaa_

PDB Entry: 3zza, 1.8 Å

PDB Description: crystal structure of 3c protease of coxsackievirus b3 complexed with alpha, beta-unsaturated ethyl ester inhibitor 84

PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d3zzaa_:

Sequence; same for both SEQRES and ATOM records:

>d3zzaa_ b.47.1.4 (A:) automated matches {Human coxsackievirus [TaxId: 12072]}
mgpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvlda
kelvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqv
teygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyf
n

Timeline for d3zzaa_:

• d3zzaa_ first appeared in SCOPe 2.02
  
• d3zzaa_ appears in SCOPe 2.04
  
• d3zzaa_ is called d3zzaa1 in SCOPe 2.06
  
• d3zzaa_ appears in the current release, SCOPe 2.08, called d3zzaa1