SCOPe 2.02: Domain d3zz9a_: 3zz9 A:

Lineage for d3zz9a_ (3zz9 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein automated matches [190384] (12 species)
   not a true protein

7. Species Coxsackievirus b3 [TaxId:103903] [188647] (7 PDB entries)

8. Domain d3zz9a_: 3zz9 A: [194656]
   automated match to d2vb0a_
   complexed with g83

Details for d3zz9a_

PDB Entry: 3zz9, 1.9 Å

PDB Description: crystal structure of 3c protease of coxsackievirus b3 complexed with alpha, beta-unsaturated ethyl ester inhibitor 83

PDB Compounds: (A:) 3C proteinase

SCOPe Domain Sequences for d3zz9a_:

Sequence; same for both SEQRES and ATOM records:

>d3zz9a_ b.47.1.4 (A:) automated matches {Coxsackievirus b3 [TaxId: 103903]}
mgpafefavammkrnsstvkteygeftmlgiydrwavlprhakpgptilmndqevgvlda
kelvdkdgtnleltllklnrnekfrdirgflakeevevneavlaintskfpnmyipvgqv
teygflnlggtptkrmlmynfptragqcggvlmstgkvlgihvggnghqgfsaallkhyf
n

Timeline for d3zz9a_:

• d3zz9a_ is new in SCOPe 2.02-stable
  
• d3zz9a_ appears in SCOPe 2.03
  
• d3zz9a_ appears in the current release, SCOPe 2.08, called d3zz9a1