Lineage for d4faha_ (4fah A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070570Family b.82.1.23: Gentisate 1,2-dioxygenase-like [159299] (2 protein domains)
    Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin; homotetramer
  6. 2070582Protein automated matches [190924] (1 species)
    not a true protein
  7. 2070583Species Pseudaminobacter salicylatoxidans [TaxId:93369] [188421] (10 PDB entries)
  8. 2070589Domain d4faha_: 4fah A: [194642]
    automated match to d2phdb_
    complexed with fe; mutant

Details for d4faha_

PDB Entry: 4fah (more details), 2.5 Å

PDB Description: Crystal Structure of the Salicylate 1,2-dioxygenase from Pseudoaminobacter salicylatoxidans A85H mutant
PDB Compounds: (A:) Gentisate 1,2-dioxygenase

SCOPe Domain Sequences for d4faha_:

Sequence, based on SEQRES records: (download)

>d4faha_ b.82.1.23 (A:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]}
mqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgel
vpvgrggerrhlglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegeg
vwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgsd
rvtdyatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqp
atvapghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvm
ngettklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegq

Sequence, based on observed residues (ATOM records): (download)

>d4faha_ b.82.1.23 (A:) automated matches {Pseudaminobacter salicylatoxidans [TaxId: 93369]}
mqpkdtpelralyksfeeesiiplwtqlgdlmpihpkskavphvwkwstllrlarksgel
vpvgrggerrhlglanpglggnayisptmwagiqylgpretapehrhsqnafrfvvegeg
vwtvvngdpvrmsrgdllltpgwcfhghmndtdqpmawidgldipfsqqmdvgffefgst
dyatpnfsrgerlwchpglrplsglqntvaspigayrweftdralteqllledegqpatv
apghaairyvnpttggdvmptlrcefhrlragtetatrnevgstvfqvfegagavvmnge
ttklekgdmfvvpswvpwslqaetqfdlfrfsdapimealsfmrtkiegq

SCOPe Domain Coordinates for d4faha_:

Click to download the PDB-style file with coordinates for d4faha_.
(The format of our PDB-style files is described here.)

Timeline for d4faha_: