Lineage for d4fqfa_ (4fqf A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140678Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species)
  7. 2140702Species Human (Homo sapiens), mitochondrial [TaxId:9606] [53726] (27 PDB entries)
    Uniprot P05091
  8. 2140775Domain d4fqfa_: 4fqf A: [194633]
    automated match to d1bi9a_
    complexed with 2no, mg, na, nad, ure

Details for d4fqfa_

PDB Entry: 4fqf (more details), 2.28 Å

PDB Description: Crystal structure of a thionitrate intermediate of human aldehyde dehydrogenase-2
PDB Compounds: (A:) aldehyde dehydrogenase, mitochondrial

SCOPe Domain Sequences for d4fqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fqfa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
qqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaaraafql
gspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvlkclryy
agwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatgnvvvmk
vaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgsteigrv
iqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcccagsrtfvqe
diydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegakllcggg
iaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyglaaavf
tkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqaytevktvt
vkvpqkns

SCOPe Domain Coordinates for d4fqfa_:

Click to download the PDB-style file with coordinates for d4fqfa_.
(The format of our PDB-style files is described here.)

Timeline for d4fqfa_: