![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (5 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:573] [189718] (11 PDB entries) |
![]() | Domain d4h0db_: 4h0d B: [194620] automated match to d3srxa_ complexed with edo, fmt, gol, mn, na, so4, zz7 |
PDB Entry: 4h0d (more details), 1.5 Å
SCOPe Domain Sequences for d4h0db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h0db_ d.157.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]} airptigqqmetgdqrfgdlvfrqlapnvwqhtsyldmpgfgavasnglivrdggrvlvv dtawtddqtaqilnwikqeinlpvalavvthahqdkmggmdalhaagiatyanalsnqla pqegmvaaqhsltfaangwvepatapnfgplkvfypgpghtsdnitvgidgtdiafggcl ikdskakslgnlgdadtehyaasarafgaafpkasmivmshsapdsraaithtarmadkl r
Timeline for d4h0db_: