Lineage for d3txza_ (3txz A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080304Protein Old yellow enzyme (OYE) [51401] (2 species)
  7. 2080305Species Lager yeast (Saccharomyces pastorianus) [TaxId:27292] [51402] (20 PDB entries)
  8. 2080317Domain d3txza_: 3txz A: [194617]
    automated match to d1k03a_
    complexed with 07v, fmn, mg

Details for d3txza_

PDB Entry: 3txz (more details), 1.7 Å

PDB Description: OYE1-W116Q complexed with R-carvone
PDB Compounds: (A:) nadph dehydrogenase 1

SCOPe Domain Sequences for d3txza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3txza_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]}
sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqlqvlgw
aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk

SCOPe Domain Coordinates for d3txza_:

Click to download the PDB-style file with coordinates for d3txza_.
(The format of our PDB-style files is described here.)

Timeline for d3txza_: