Lineage for d3tyhi_ (3tyh I:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1185502Protein Ferric-binding protein FbpA [53867] (7 species)
  7. 1185526Species Neisseria gonorrhoeae [TaxId:485] [53869] (5 PDB entries)
    Uniprot Q50964 23-331
  8. 1185554Domain d3tyhi_: 3tyh I: [194616]
    automated match to d1xc1a_
    complexed with cu

Details for d3tyhi_

PDB Entry: 3tyh (more details), 2.1 Å

PDB Description: Crystal structure of oxo-cupper clusters binding to ferric binding protein from Neisseria gonorrhoeae
PDB Compounds: (I:) FbpA protein

SCOPe Domain Sequences for d3tyhi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tyhi_ c.94.1.1 (I:) Ferric-binding protein FbpA {Neisseria gonorrhoeae [TaxId: 485]}
ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
rlleqagmk

SCOPe Domain Coordinates for d3tyhi_:

Click to download the PDB-style file with coordinates for d3tyhi_.
(The format of our PDB-style files is described here.)

Timeline for d3tyhi_: