![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
![]() | Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family) ![]() long alpha-helix interrupted in the middle automatically mapped to Pfam PF00631 |
![]() | Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein) |
![]() | Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [48673] (20 PDB entries) |
![]() | Domain d3v5wg_: 3v5w G: [194615] Other proteins in same PDB: d3v5wa1, d3v5wa2, d3v5wa3, d3v5wb_ automated match to d2bcjg1 complexed with 8pr, mg |
PDB Entry: 3v5w (more details), 2.07 Å
SCOPe Domain Sequences for d3v5wg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v5wg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]} siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrek
Timeline for d3v5wg_:
![]() Domains from other chains: (mouse over for more information) d3v5wa1, d3v5wa2, d3v5wa3, d3v5wb_ |