SCOPe 2.08: Domain d3v3rb_: 3v3r B:

Lineage for d3v3rb_ (3v3r B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.0: automated matches [191512] (1 protein)
   not a true family

6. Protein automated matches [190857] (70 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [194613] (64 PDB entries)

8. Domain d3v3rb_: 3v3r B: [194614]
   automated match to d3ni9a_
   complexed with iod, na

Details for d3v3rb_

PDB Entry: 3v3r, 1.9 Å

PDB Description: Crystal Structure of GES-11

PDB Compounds: (B:) Extended spectrum class A beta-lactamase GES-11

SCOPe Domain Sequences for d3v3rb_:

Sequence; same for both SEQRES and ATOM records:

>d3v3rb_ e.3.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
sekltfktdleklerekaaqigvaivdpqgeivaghrmaqrfamcstfkfplaalvferi
dsgtergdrklsygpdmivewspaterflasghmtvleaaqaavqlsdngatnlllreig
gpaamtqyfrkigdsvsrldrkepemgdntpgdlrdtttpiamartvakvlyggaltsts
thtierwlignqtgdatlragfpkdwvvgektgtcangarndigffkaqerdyavavytt
apklsaverdelvasvgqvitqlil

Timeline for d3v3rb_:

• d3v3rb_ first appeared in SCOPe 2.02
  
• d3v3rb_ appears in SCOPe 2.07