SCOPe 2.07: Domain d2v7ab_: 2v7a B:

Lineage for d2v7ab_ (2v7a B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (892 PDB entries)

8. Domain d2v7ab_: 2v7a B: [194610]
   automated match to d3ik3a_
   complexed with 627, mg; mutant

Details for d2v7ab_

PDB Entry: 2v7a, 2.5 Å

PDB Description: crystal structure of the t315i abl mutant in complex with the inhibitor pha-739358

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2v7ab_:

Sequence; same for both SEQRES and ATOM records:

>d2v7ab_ d.144.1.7 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaavmkei
khpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevnavvllymatqissamey
lekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtapeslay
nkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvyelmr
acwqwnpsdrpsfaeihqafetmfqessis

Timeline for d2v7ab_:

• d2v7ab_ first appeared in SCOPe 2.02
  
• d2v7ab_ appears in SCOPe 2.06
  
• d2v7ab_ appears in the current release, SCOPe 2.08