Lineage for d1derb1 (1der B:2-136,B:410-526)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51151Fold a.129: GroEL-like chaperones, ATPase domain [48591] (1 superfamily)
  4. 51152Superfamily a.129.1: GroEL-like chaperones, ATPase domain [48592] (2 families) (S)
  5. 51153Family a.129.1.1: GroEL [48593] (1 protein)
  6. 51154Protein GroEL [48594] (1 species)
  7. 51155Species Escherichia coli [TaxId:562] [48595] (4 PDB entries)
  8. 51164Domain d1derb1: 1der B:2-136,B:410-526 [19460]
    Other proteins in same PDB: d1dera2, d1dera3, d1derb2, d1derb3, d1derc2, d1derc3, d1derd2, d1derd3, d1dere2, d1dere3, d1derf2, d1derf3, d1derg2, d1derg3, d1derh2, d1derh3, d1deri2, d1deri3, d1derj2, d1derj3, d1derk2, d1derk3, d1derl2, d1derl3, d1derm2, d1derm3, d1dern2, d1dern3

Details for d1derb1

PDB Entry: 1der (more details), 2.4 Å

PDB Description: the 2.4 angstrom crystal structure of the bacterial chaperonin groel complexed with atp-gamma-s

SCOP Domain Sequences for d1derb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1derb1 a.129.1.1 (B:2-136,B:410-526) GroEL {Escherichia coli}
aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtvaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlpk

SCOP Domain Coordinates for d1derb1:

Click to download the PDB-style file with coordinates for d1derb1.
(The format of our PDB-style files is described here.)

Timeline for d1derb1: