SCOPe 2.06: Domain d4gh6a_: 4gh6 A:

Lineage for d4gh6a_ (4gh6 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (20 PDB entries)
   Uniprot O76083 241-566

8. Domain d4gh6a_: 4gh6 A: [194598]
   automated match to d2hd1a_
   complexed with luo, mg, zn

Details for d4gh6a_

PDB Entry: 4gh6, 2.7 Å

PDB Description: Crystal structure of the PDE9A catalytic domain in complex with inhibitor 28

PDB Compounds: (A:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d4gh6a_:

Sequence; same for both SEQRES and ATOM records:

>d4gh6a_ a.211.1.2 (A:) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
ptypkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlf
cvhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgyn
ntyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitli
latdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcl
leeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeiml
qplwesrdryeelkriddamkelqkk

Timeline for d4gh6a_:

• d4gh6a_ first appeared in SCOPe 2.02
  
• d4gh6a_ appears in SCOPe 2.05
  
• d4gh6a_ appears in SCOPe 2.07
  
• d4gh6a_ appears in the current release, SCOPe 2.08