SCOPe 2.02: Domain d4gxma_: 4gxm A:

Lineage for d4gxma_ (4gxm A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein Old yellow enzyme (OYE) [51401] (2 species)

7. Species Lager yeast (Saccharomyces pastorianus) [TaxId:27292] [51402] (12 PDB entries)

8. Domain d4gxma_: 4gxm A: [194593]
   automated match to d1k03a_
   complexed with 0wv, 1pe, cl, fmn, mg, na; mutant

Details for d4gxma_

PDB Entry: 4gxm, 1.36 Å

PDB Description: OYE1-W116L in complex with aromatic product of R-carvone dismutation

PDB Compounds: (A:) nadph dehydrogenase 1

SCOPe Domain Sequences for d4gxma_:

Sequence; same for both SEQRES and ATOM records:

>d4gxma_ c.1.4.1 (A:) Old yellow enzyme (OYE) {Lager yeast (Saccharomyces pastorianus) [TaxId: 27292]}
sfvkdfkpqalgdtnlfkpikignnellhravippltrmralhpgnipnrdwaveyytqr
aqrpgtmiitegafispqaggydnapgvwseeqmvewtkifnaihekksfvwvqllvlgw
aafpdnlardglrydsasdnvfmdaeqeakakkannpqhsltkdeikqyikeyvqaakns
iaagadgveihsangyllnqfldphsntrtdeyggsienrarftlevvdalveaighekv
glrlspygvfnsmsggaetgivaqyayvagelekrakagkrlafvhlveprvtnpflteg
egeyeggsndfvysiwkgpviragnfalhpevvreevkdkrtligygrffisnpdlvdrl
ekglplnkydrdtfyqmsahgyidyptyeealklgwdkk

Timeline for d4gxma_:

• d4gxma_ is new in SCOPe 2.02-stable
  
• d4gxma_ appears in SCOPe 2.03
  
• d4gxma_ appears in the current release, SCOPe 2.08