Lineage for d3twha_ (3twh A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493669Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2493670Protein BH0863-like Ribonuclease H [142490] (3 species)
    new class of RNase H
  7. 2493671Species Bacillus halodurans [TaxId:86665] [142491] (21 PDB entries)
    Uniprot Q9KEI9 61-193! Uniprot Q9KEI9 62-193
    BH0863
  8. 2493693Domain d3twha_: 3twh A: [194591]
    automated match to d3ey1a_
    protein/DNA complex; protein/RNA complex; complexed with mg, po4; mutant

Details for d3twha_

PDB Entry: 3twh (more details), 1.79 Å

PDB Description: Selenium Derivatized RNA/DNA Hybrid in complex with RNase H Catalytic Domain D132N Mutant
PDB Compounds: (A:) Ribonuclease H

SCOPe Domain Sequences for d3twha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3twha_ c.55.3.1 (A:) BH0863-like Ribonuclease H {Bacillus halodurans [TaxId: 86665]}
eeiiweslsvdvgsqgnpgiveykgvdtktgevlferepipigtnnmgeflaivhglryl
kernsrkpiysnsqtaikwvkdkkakstlvrneetaliwklvdeaeewlnthtyetpilk
wqtdkwgeikadyg

SCOPe Domain Coordinates for d3twha_:

Click to download the PDB-style file with coordinates for d3twha_.
(The format of our PDB-style files is described here.)

Timeline for d3twha_: