![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
![]() | Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins) automatically mapped to Pfam PF00145 |
![]() | Protein automated matches [190244] (3 species) not a true protein |
![]() | Species Haemophilus aegyptius [TaxId:197575] [194587] (1 PDB entry) |
![]() | Domain d3ubtb_: 3ubt B: [194588] automated match to d1dcta_ protein/DNA complex; complexed with 2pe, atp, cl; mutant |
PDB Entry: 3ubt (more details), 2.5 Å
SCOPe Domain Sequences for d3ubtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ubtb_ c.66.1.26 (B:) automated matches {Haemophilus aegyptius [TaxId: 197575]} mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp kcdgiiggppsqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg ykmignavpvnlayeiaktiksaleick
Timeline for d3ubtb_: