Lineage for d3ubtb_ (3ubt B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145958Family c.66.1.26: C5 cytosine-specific DNA methylase, DCM [88786] (5 proteins)
    automatically mapped to Pfam PF00145
  6. 2146003Protein automated matches [190244] (3 species)
    not a true protein
  7. 2146004Species Haemophilus aegyptius [TaxId:197575] [194587] (1 PDB entry)
  8. 2146006Domain d3ubtb_: 3ubt B: [194588]
    automated match to d1dcta_
    protein/DNA complex; complexed with 2pe, atp, cl; mutant

Details for d3ubtb_

PDB Entry: 3ubt (more details), 2.5 Å

PDB Description: Crystal Structure of C71S Mutant of DNA Cytosine-5 Methyltransferase M.HaeIII Bound to DNA
PDB Compounds: (B:) Modification methylase HaeIII

SCOPe Domain Sequences for d3ubtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ubtb_ c.66.1.26 (B:) automated matches {Haemophilus aegyptius [TaxId: 197575]}
mnlislfsgaggldlgfqkagfriicaneydksiwktyesnhsaklikgdiskissdefp
kcdgiiggppsqswseggslrgiddprgklfyeyirilkqkkpifflaenvkgmmaqrhn
kavqefiqefdnagydvhiillnandygvaqdrkrvfyigfrkelninylppiphlikpt
fkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqa
sgrqcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndg
ykmignavpvnlayeiaktiksaleick

SCOPe Domain Coordinates for d3ubtb_:

Click to download the PDB-style file with coordinates for d3ubtb_.
(The format of our PDB-style files is described here.)

Timeline for d3ubtb_: