| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore |
| Protein automated matches [190531] (8 species) not a true protein |
| Species Porphyridium purpureum [TaxId:35688] [194584] (1 PDB entry) |
| Domain d3v58c_: 3v58 C: [194586] automated match to d1eyxa_ complexed with peb, so4 |
PDB Entry: 3v58 (more details), 1.85 Å
SCOPe Domain Sequences for d3v58c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3v58c_ a.1.1.3 (C:) automated matches {Porphyridium purpureum [TaxId: 35688]}
mksvittvvsaadaagrfpsnsdlesiqgniqrsaarleaaeklagnheavvkeagdacf
akyaylknpgeagenqekinkcyrdvdhymrlvnyclvvggtgpldewgiagarevyrtl
nlptsayvasiaytrdrlcvprdmsaqagvefsayldylinals
Timeline for d3v58c_: