SCOPe 2.06: Domain d4a1yc1: 4a1y C:0-131

Lineage for d4a1yc1 (4a1y C:0-131)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (18 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein automated matches [190295] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187133] (57 PDB entries)

8. Domain d4a1yc1: 4a1y C:0-131 [194582]
   Other proteins in same PDB: d4a1ya2, d4a1yb2, d4a1yc2, d4a1yd2
   automated match to d2wuta_
   complexed with cl, plm; mutant

Details for d4a1yc1

PDB Entry: 4a1y, 1.2 Å

PDB Description: human myelin p2 protein, k65q mutant

PDB Compounds: (C:) myelin p2 protein

SCOPe Domain Sequences for d4a1yc1:

Sequence; same for both SEQRES and ATOM records:

>d4a1yc1 b.60.1.2 (C:0-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msnkflgtwklvssenfddymkalgvglatrklgnlakptviiskkgdiitirtestfkn
teisfqlgqefeettadnrktksivtlqrgslnqvqrwdgkettikrklvngkmvaeckm
kgvvctriyekv

Timeline for d4a1yc1:

• d4a1yc1 first appeared in SCOPe 2.02, called d4a1yc_
  
• d4a1yc1 was called d4a1yc_ in SCOPe 2.05
  
• d4a1yc1 appears in SCOPe 2.07
  
• d4a1yc1 appears in the current release, SCOPe 2.08