Lineage for d4ahja_ (4ahj A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1192691Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1192692Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1192693Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1193024Protein automated matches [190061] (4 species)
    not a true protein
  7. 1193139Species Human (Homo sapiens) [TaxId:9606] [186903] (6 PDB entries)
  8. 1193149Domain d4ahja_: 4ahj A: [194579]
    automated match to d1a4yb_
    complexed with tar; mutant

Details for d4ahja_

PDB Entry: 4ahj (more details), 2.03 Å

PDB Description: I46V - Angiogenin mutants and amyotrophic lateral sclerosis - a biochemical and biological analysis
PDB Compounds: (A:) angiogenin

SCOPe Domain Sequences for d4ahja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ahja_ d.5.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dnsrythfltqhydakpqgrddrycesimrrrgltspckdintfvhgnkrsikaicenkn
gnphrqnlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsifr
r

SCOPe Domain Coordinates for d4ahja_:

Click to download the PDB-style file with coordinates for d4ahja_.
(The format of our PDB-style files is described here.)

Timeline for d4ahja_: