Lineage for d4ahna_ (4ahn A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174511Protein Angiogenin [54094] (2 species)
  7. 2174515Species Human (Homo sapiens) [TaxId:9606] [54095] (45 PDB entries)
  8. 2174565Domain d4ahna_: 4ahn A: [194577]
    automated match to d1a4yb_
    complexed with cl; mutant

Details for d4ahna_

PDB Entry: 4ahn (more details), 2.98 Å

PDB Description: R121H - Angiogenin mutants and amyotrophic lateral sclerosis - a biochemical and biological analysis
PDB Compounds: (A:) angiogenin

SCOPe Domain Sequences for d4ahna_:

Sequence, based on SEQRES records: (download)

>d4ahna_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]}
dnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkn
gnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsifh
r

Sequence, based on observed residues (ATOM records): (download)

>d4ahna_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]}
dnsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkn
gnphrenlriskssfqvttcklhgspwppcqyratagfrnvvvacenglpvhldqsifhr

SCOPe Domain Coordinates for d4ahna_:

Click to download the PDB-style file with coordinates for d4ahna_.
(The format of our PDB-style files is described here.)

Timeline for d4ahna_: