![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
![]() | Superfamily d.5.1: RNase A-like [54076] (2 families) ![]() can be classified as disulfide-rich |
![]() | Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
![]() | Protein Angiogenin [54094] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54095] (45 PDB entries) |
![]() | Domain d4ahla_: 4ahl A: [194575] automated match to d1a4yb_ complexed with tla; mutant |
PDB Entry: 4ahl (more details), 2.05 Å
SCOPe Domain Sequences for d4ahla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ahla_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]} srythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkngn phrenlriskssfqvttcklhggspwppcqyratagfrnvvvacengllvhldqsifrr
Timeline for d4ahla_: