Lineage for d4ahka_ (4ahk A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1635083Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1635084Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1635085Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1635111Protein Angiogenin [54094] (2 species)
  7. 1635115Species Human (Homo sapiens) [TaxId:9606] [54095] (30 PDB entries)
  8. 1635121Domain d4ahka_: 4ahk A: [194570]
    automated match to d1a4yb_
    complexed with tar; mutant

Details for d4ahka_

PDB Entry: 4ahk (more details), 1.97 Å

PDB Description: K54E - Angiogenin mutants and amyotrophic lateral sclerosis - a biochemical and biological analysis
PDB Compounds: (A:) angiogenin

SCOPe Domain Sequences for d4ahka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ahka_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]}
nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsieaicenkng
nphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsifrr

SCOPe Domain Coordinates for d4ahka_:

Click to download the PDB-style file with coordinates for d4ahka_.
(The format of our PDB-style files is described here.)

Timeline for d4ahka_: