Lineage for d1oelf1 (1oel F:2-136,F:410-525)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 51151Fold a.129: GroEL-like chaperones, ATPase domain [48591] (1 superfamily)
  4. 51152Superfamily a.129.1: GroEL-like chaperones, ATPase domain [48592] (2 families) (S)
  5. 51153Family a.129.1.1: GroEL [48593] (1 protein)
  6. 51154Protein GroEL [48594] (1 species)
  7. 51155Species Escherichia coli [TaxId:562] [48595] (4 PDB entries)
  8. 51161Domain d1oelf1: 1oel F:2-136,F:410-525 [19457]
    Other proteins in same PDB: d1oela2, d1oela3, d1oelb2, d1oelb3, d1oelc3, d1oelc4, d1oeld2, d1oeld3, d1oele2, d1oele3, d1oelf2, d1oelf3, d1oelg2, d1oelg3

Details for d1oelf1

PDB Entry: 1oel (more details), 2.8 Å

PDB Description: conformational variability in the refined structure of the chaperonin groel at 2.8 angstrom resolution

SCOP Domain Sequences for d1oelf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oelf1 a.129.1.1 (F:2-136,F:410-525) GroEL {Escherichia coli}
aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtvaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOP Domain Coordinates for d1oelf1:

Click to download the PDB-style file with coordinates for d1oelf1.
(The format of our PDB-style files is described here.)

Timeline for d1oelf1: