SCOPe 2.02: Domain d4ahma_: 4ahm A:

Lineage for d4ahma_ (4ahm A:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Angiogenin [54094] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54095] (30 PDB entries)

8. Domain d4ahma_: 4ahm A: [194569]
   automated match to d1a4yb_
   complexed with tla; mutant

Details for d4ahma_

PDB Entry: 4ahm, 1.96 Å

PDB Description: V113I - Angiogenin mutants and amyotrophic lateral sclerosis - a biochemical and biological analysis

PDB Compounds: (A:) angiogenin

SCOPe Domain Sequences for d4ahma_:

Sequence; same for both SEQRES and ATOM records:

>d4ahma_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]}
nsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenkng
nphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpihldqsifrr

Timeline for d4ahma_:

• d4ahma_ is new in SCOPe 2.02-stable
  
• d4ahma_ appears in SCOPe 2.03
  
• d4ahma_ appears in the current release, SCOPe 2.08