Lineage for d4as4b_ (4as4 B:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3015828Fold e.7: Carbohydrate phosphatase [56654] (1 superfamily)
    N-terminal domain is an alpha+beta, C-terminal domain is an alpha/beta with mixed beta-sheet
  4. 3015829Superfamily e.7.1: Carbohydrate phosphatase [56655] (3 families) (S)
  5. 3015830Family e.7.1.1: Inositol monophosphatase/fructose-1,6-bisphosphatase-like [56656] (7 proteins)
  6. 3016047Protein Inositol monophosphatase [56663] (1 species)
  7. 3016048Species Human (Homo sapiens) [TaxId:9606] [56664] (11 PDB entries)
  8. 3016050Domain d4as4b_: 4as4 B: [194566]
    automated match to d1imba_
    complexed with gol, mg, po4

Details for d4as4b_

PDB Entry: 4as4 (more details), 1.7 Å

PDB Description: Structure of human inositol monophosphatase 1
PDB Compounds: (B:) inositol monophosphatase 1

SCOPe Domain Sequences for d4as4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4as4b_ e.7.1.1 (B:) Inositol monophosphatase {Human (Homo sapiens) [TaxId: 9606]}
dpwqecmdyavtlarqagevvceaiknemnvmlksspvdlvtatdqkvekmlissikeky
pshsfigeesvaageksiltdnptwiidpidgttnfvhrfpfvavsigfavnkkiefgvv
yscvegkmytarkgkgafcngqklqvsqqeditksllvtelgssrtpetvrmvlsnmekl
fcipvhgirsvgtaavnmclvatggadayyemgihcwdvagagiivteaggvlmdvtggp
fdlmsrrviaannrilaeriakeiqviplqrdde

SCOPe Domain Coordinates for d4as4b_:

Click to download the PDB-style file with coordinates for d4as4b_.
(The format of our PDB-style files is described here.)

Timeline for d4as4b_: