Lineage for d4ekfa_ (4ekf A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399503Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 1399504Protein Human adenovirus 2 proteinase, adenain [54055] (1 species)
  7. 1399505Species Mastadenovirus H2 [TaxId:10515] [54056] (3 PDB entries)
  8. 1399506Domain d4ekfa_: 4ekf A: [194563]
    automated match to d1avpa_
    complexed with na

Details for d4ekfa_

PDB Entry: 4ekf (more details), 0.98 Å

PDB Description: structure of the inactive adenovirus proteinase at 0.98 angstrom resolution
PDB Compounds: (A:) Adenain

SCOPe Domain Sequences for d4ekfa_:

Sequence, based on SEQRES records: (download)

>d4ekfa_ d.3.1.7 (A:) Human adenovirus 2 proteinase, adenain {Mastadenovirus H2 [TaxId: 10515]}
mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafaw
nprsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsa
acglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysfler
hspyfrshsaqirsatsfchlknm

Sequence, based on observed residues (ATOM records): (download)

>d4ekfa_ d.3.1.7 (A:) Human adenovirus 2 proteinase, adenain {Mastadenovirus H2 [TaxId: 10515]}
mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntaggvhwmafawnprs
ktcylfepfgfsdqrlkqvyqfeyesllrrsaitlekstqsvqgpnsaacglfccmflha
fanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysflerhspyfrshsaqi
rsatsfchlknm

SCOPe Domain Coordinates for d4ekfa_:

Click to download the PDB-style file with coordinates for d4ekfa_.
(The format of our PDB-style files is described here.)

Timeline for d4ekfa_: