![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
![]() | Protein Human adenovirus 2 proteinase, adenain [54055] (1 species) |
![]() | Species Mastadenovirus H2 [TaxId:10515] [54056] (3 PDB entries) |
![]() | Domain d4ekfa_: 4ekf A: [194563] automated match to d1avpa_ complexed with na |
PDB Entry: 4ekf (more details), 0.98 Å
SCOPe Domain Sequences for d4ekfa_:
Sequence, based on SEQRES records: (download)
>d4ekfa_ d.3.1.7 (A:) Human adenovirus 2 proteinase, adenain {Mastadenovirus H2 [TaxId: 10515]} mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntagretggvhwmafaw nprsktcylfepfgfsdqrlkqvyqfeyesllrrsaiasspdrcitlekstqsvqgpnsa acglfccmflhafanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysfler hspyfrshsaqirsatsfchlknm
>d4ekfa_ d.3.1.7 (A:) Human adenovirus 2 proteinase, adenain {Mastadenovirus H2 [TaxId: 10515]} mgsseqelkaivkdlgcgpyflgtydkrfpgfvsphklacaivntaggvhwmafawnprs ktcylfepfgfsdqrlkqvyqfeyesllrrsaitlekstqsvqgpnsaacglfccmflha fanwpqtpmdhnptmnlitgvpnsmlnspqvqptlrrnqeqlysflerhspyfrshsaqi rsatsfchlknm
Timeline for d4ekfa_: