Lineage for d4fs4a_ (4fs4 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2799129Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2799130Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2800798Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2800856Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2800857Species Human (Homo sapiens) [TaxId:9606] [50672] (329 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2800981Domain d4fs4a_: 4fs4 A: [194562]
    automated match to d2qk5a_
    complexed with h24, tla

Details for d4fs4a_

PDB Entry: 4fs4 (more details), 1.74 Å

PDB Description: Structure of BACE Bound to (S)-4-(3'-methoxy-[1,1'-biphenyl]-3-yl)-1,4-dimethyl-6-oxotetrahydropyrimidin-2(1H)-iminium
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d4fs4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fs4a_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyni

SCOPe Domain Coordinates for d4fs4a_:

Click to download the PDB-style file with coordinates for d4fs4a_.
(The format of our PDB-style files is described here.)

Timeline for d4fs4a_: