SCOPe 2.05: Domain d4fsle_: 4fsl E:

Lineage for d4fsle_ (4fsl E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.2: Pepsin-like [50646] (11 proteins)
   duplication: consists of two similar barrel domains
   N-terminal: barrel, partly opened; n*=6, S*=10

6. Protein beta-secretase (memapsin) [50671] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50672] (258 PDB entries)
   Uniprot P56817 58-446 ! Uniprot P56817 60-447

8. Domain d4fsle_: 4fsl E: [194560]
   automated match to d3kmxa_
   complexed with 0vb, iod

Details for d4fsle_

PDB Entry: 4fsl, 2.5 Å

PDB Description: crystal structure of beta-site app-cleaving enzyme 1 (bace-db-mut) complex with n-(n-(4- acetamido-3-chloro-5-methylbenzyl) carbamimidoyl)-3-(4- methoxyphenyl)-5-methyl-4-isothiazolecarboxamide

PDB Compounds: (E:) Beta-secretase 1

SCOPe Domain Sequences for d4fsle_:

Sequence; same for both SEQRES and ATOM records:

>d4fsle_ b.50.1.2 (E:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
kvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
tilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
chvhdefrtaavegpfvtldmedcgyn

Timeline for d4fsle_:

• d4fsle_ first appeared in SCOPe 2.02
  
• d4fsle_ appears in SCOPe 2.04
  
• d4fsle_ appears in SCOPe 2.06
  
• d4fsle_ appears in the current release, SCOPe 2.08