Lineage for d4gida_ (4gid A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1549490Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1549547Protein beta-secretase (memapsin) [50671] (1 species)
  7. 1549548Species Human (Homo sapiens) [TaxId:9606] [50672] (242 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 1549722Domain d4gida_: 4gid A: [194556]
    automated match to d1fkna_
    complexed with 0gh, lpd

Details for d4gida_

PDB Entry: 4gid (more details), 2 Å

PDB Description: Structure of beta-secretase complexed with inhibitor
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d4gida_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gida_ b.50.1.2 (A:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
kvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
tilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
chvhdefrtaavegpfvtldmedcgyn

SCOPe Domain Coordinates for d4gida_:

Click to download the PDB-style file with coordinates for d4gida_.
(The format of our PDB-style files is described here.)

Timeline for d4gida_: