Lineage for d1oeld1 (1oel D:2-136,D:410-525)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732284Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily)
    multihelical; 8 helices arranged in 2 parallel layers
  4. 2732285Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) (S)
    duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site
  5. 2732286Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein)
  6. 2732287Protein GroEL, E domain [48594] (4 species)
  7. 2732288Species Escherichia coli [TaxId:562] [48595] (11 PDB entries)
  8. 2732320Domain d1oeld1: 1oel D:2-136,D:410-525 [19455]
    Other proteins in same PDB: d1oela2, d1oela3, d1oelb2, d1oelb3, d1oelc3, d1oelc4, d1oeld2, d1oeld3, d1oele2, d1oele3, d1oelf2, d1oelf3, d1oelg2, d1oelg3

Details for d1oeld1

PDB Entry: 1oel (more details), 2.8 Å

PDB Description: conformational variability in the refined structure of the chaperonin groel at 2.8 angstrom resolution
PDB Compounds: (D:) groEL (hsp60 class)

SCOPe Domain Sequences for d1oeld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oeld1 a.129.1.1 (D:2-136,D:410-525) GroEL, E domain {Escherichia coli [TaxId: 562]}
aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie
ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid
kavtvaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq
ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl
mittecmvtdlp

SCOPe Domain Coordinates for d1oeld1:

Click to download the PDB-style file with coordinates for d1oeld1.
(The format of our PDB-style files is described here.)

Timeline for d1oeld1: