Class a: All alpha proteins [46456] (284 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (4 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein automated matches [193445] (1 species) not a true protein |
Species Homo sapiens [TaxId:9606] [193446] (12 PDB entries) |
Domain d4h9oa_: 4h9o A: [194548] Other proteins in same PDB: d4h9ob_ automated match to d1kx5a_ protein/DNA complex; complexed with po4 |
PDB Entry: 4h9o (more details), 2.05 Å
SCOPe Domain Sequences for d4h9oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h9oa_ a.22.1.1 (A:) automated matches {Homo sapiens [TaxId: 9606]} phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqsaaimalqeaae aflvalfedtnlctihakrvtifpkdiqlarrirger
Timeline for d4h9oa_: