Lineage for d4ha3a_ (4ha3 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2083072Protein automated matches [190245] (11 species)
    not a true protein
  7. 2083073Species Acidilobus saccharovorans [TaxId:666510] [194546] (2 PDB entries)
  8. 2083075Domain d4ha3a_: 4ha3 A: [194547]
    automated match to d1gowa_
    complexed with gol, mg, peg, trs

Details for d4ha3a_

PDB Entry: 4ha3 (more details), 1.46 Å

PDB Description: Structure of beta-glycosidase from Acidilobus saccharovorans in complex with Tris
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d4ha3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ha3a_ c.1.8.4 (A:) automated matches {Acidilobus saccharovorans [TaxId: 666510]}
avtfpkdflfgwsqagfqsemgtpgsedpnsdwyawvhdreniaaglvsgdfpengpgyw
gnyrkfhdaaqamgltaarigvewsrifprptfdvkvdaevkgddvlsvyvsegaleqld
kmanrdainhyremfsdlrsrgitfilnlyhwplplwlhdpiairrgnlsapsgwldvrt
viefakfsayvawklddlvymystmnepnvvwglgyaavksgfppgylclecagramknl
vqaharaydavkaitkkpvgviyansdftpltdadreaaerakfdnrwaffdavvrgqlg
gstrddlkgrldwigvnyytrqvvrargsgyeivpgyghgcepngvspagrpcsdfgwef
ypeglynvlkeywdryhlpllvtengiadegdyqrpyylvshvyqvhralqdgvnvigyl
hwsladnyewasgfskrfgllmvdystkrlhwrpsafiyreiaksraitdeiehlnsvpp
lrglspghr

SCOPe Domain Coordinates for d4ha3a_:

Click to download the PDB-style file with coordinates for d4ha3a_.
(The format of our PDB-style files is described here.)

Timeline for d4ha3a_: