Lineage for d3tvla_ (3tvl A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1208095Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 1208096Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) (S)
  5. 1208106Family d.63.1.2: CYTH domain [118007] (5 proteins)
    Pfam PF01928
  6. 1208119Protein Thiamine-triphosphatase (ThTPase) [160428] (2 species)
  7. 1208120Species Homo sapiens [TaxId:9606] [194539] (1 PDB entry)
  8. 1208121Domain d3tvla_: 3tvl A: [194541]
    automated match to d2jmua1
    complexed with 3po, edo

Details for d3tvla_

PDB Entry: 3tvl (more details), 2.3 Å

PDB Description: Complex between the human thiamine triphosphatase and triphosphate
PDB Compounds: (A:) Thiamine-triphosphatase

SCOPe Domain Sequences for d3tvla_:

Sequence, based on SEQRES records: (download)

>d3tvla_ d.63.1.2 (A:) Thiamine-triphosphatase (ThTPase) {Homo sapiens [TaxId: 9606]}
glieverkflpgpgteerlqelggtleyrvtfrdtyydtpelslmqadhwlrrredsgwe
lkcpgaagvlgphteykeltaeptivaqlckvlradglgagdvaavlgplglqevasfvt
krsawklvllgadeeepqlrvdldtadfgyavgevealvheeaevptalekihrlssmlg
vpaqetapaklivylqrfrpqdyqrllevns

Sequence, based on observed residues (ATOM records): (download)

>d3tvla_ d.63.1.2 (A:) Thiamine-triphosphatase (ThTPase) {Homo sapiens [TaxId: 9606]}
glieverkflpgpgteerlqelggtleyrvtfrdtyydtpelslmqadhwlrrredsgwe
lkcpgaagvlgphteykeltaeptivaqlckvlradglgagdvaavlgplglqevasfvt
krsawklvlpqlrvdldtadfgyavgevealvheeaevptalekihrlssmlgvpaqeta
paklivylqrfrpqdyqrllevns

SCOPe Domain Coordinates for d3tvla_:

Click to download the PDB-style file with coordinates for d3tvla_.
(The format of our PDB-style files is described here.)

Timeline for d3tvla_: