Lineage for d3tvlb_ (3tvl B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563399Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 2563400Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) (S)
  5. 2563414Family d.63.1.2: CYTH domain [118007] (5 proteins)
    Pfam PF01928
  6. 2563429Protein Thiamine-triphosphatase (ThTPase) [160428] (2 species)
  7. 2563430Species Human (Homo sapiens) [TaxId:9606] [194539] (2 PDB entries)
  8. 2563434Domain d3tvlb_: 3tvl B: [194540]
    automated match to d2jmua1
    complexed with 3po, edo

Details for d3tvlb_

PDB Entry: 3tvl (more details), 2.3 Å

PDB Description: Complex between the human thiamine triphosphatase and triphosphate
PDB Compounds: (B:) Thiamine-triphosphatase

SCOPe Domain Sequences for d3tvlb_:

Sequence, based on SEQRES records: (download)

>d3tvlb_ d.63.1.2 (B:) Thiamine-triphosphatase (ThTPase) {Human (Homo sapiens) [TaxId: 9606]}
lieverkflpgpgteerlqelggtleyrvtfrdtyydtpelslmqadhwlrrredsgwel
kcpgaagvlgphteykeltaeptivaqlckvlradglgagdvaavlgplglqevasfvtk
rsawklvllgadeeepqlrvdldtadfgyavgevealvheeaevptalekihrlssmlgv
paqetapaklivylqrfrpqdyqrlle

Sequence, based on observed residues (ATOM records): (download)

>d3tvlb_ d.63.1.2 (B:) Thiamine-triphosphatase (ThTPase) {Human (Homo sapiens) [TaxId: 9606]}
lieverkflpgpgteerlqelggtleyrvtfrdtyydtpelslmqadhwlrrredsgwel
kcpgaagvlgphteykeltaeptivaqlckvlradglgagdvaavlgplglqevasfvtk
rsawklvlqlrvdldtadfgyavgevealvheeaevptalekihrlssmlgvpaqetapa
klivylqrfrpqdyqrlle

SCOPe Domain Coordinates for d3tvlb_:

Click to download the PDB-style file with coordinates for d3tvlb_.
(The format of our PDB-style files is described here.)

Timeline for d3tvlb_: