![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein automated matches [190047] (27 species) not a true protein |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [194536] (6 PDB entries) |
![]() | Domain d3tvdb_: 3tvd B: [194537] automated match to d1cc0a_ complexed with gsp, mg |
PDB Entry: 3tvd (more details), 2.99 Å
SCOPe Domain Sequences for d3tvdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tvdb_ c.37.1.8 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} aairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdta gqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdl rndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa
Timeline for d3tvdb_: