SCOPe 2.06: Domain d4etwc_: 4etw C:

Lineage for d4etwc_ (4etw C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.26: Biotin biosynthesis protein BioH [82509] (2 proteins)
   automatically mapped to Pfam PF12697
   automatically mapped to Pfam PF00561

6. Protein automated matches [194519] (2 species)
   not a true protein

7. Species Shigella flexneri [TaxId:623] [194520] (1 PDB entry)

8. Domain d4etwc_: 4etw C: [194534]
   Other proteins in same PDB: d4etwb_, d4etwd_
   automated match to d1m33a_
   complexed with zmk

Details for d4etwc_

PDB Entry: 4etw, 2.05 Å

PDB Description: structure of the enzyme-acp substrate gatekeeper complex required for biotin synthesis

PDB Compounds: (C:) Pimelyl-[acyl-carrier protein] methyl ester esterase

SCOPe Domain Sequences for d4etwc_:

Sequence; same for both SEQRES and ATOM records:

>d4etwc_ c.69.1.26 (C:) automated matches {Shigella flexneri [TaxId: 623]}
niwwqtkgqgnvhlvllhgwglnaevwrcideelsshftlhlvdlpgfgrsrgfgalsla
dmaeavlqqapdkaiwlgwalgglvasqialthpervqalvtvasspcfsardewpgikp
dvlagfqqqlsddfqrtverflalqtmgtetarqdaralkktvlalpmpevdvlngglei
lktvdlrqplqnvsmpflrlygyldglvprkvvpmldklwphsesyifakaahapfishp
aefchllvalkqrvl

Timeline for d4etwc_:

• d4etwc_ first appeared in SCOPe 2.02
  
• d4etwc_ appears in SCOPe 2.05
  
• d4etwc_ appears in SCOPe 2.07
  
• d4etwc_ appears in the current release, SCOPe 2.08