Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.26: Biotin biosynthesis protein BioH [82509] (2 proteins) automatically mapped to Pfam PF12697 automatically mapped to Pfam PF00561 |
Protein automated matches [194519] (2 species) not a true protein |
Species Shigella flexneri [TaxId:623] [194520] (1 PDB entry) |
Domain d4etwc_: 4etw C: [194534] Other proteins in same PDB: d4etwb_, d4etwd_ automated match to d1m33a_ complexed with zmk |
PDB Entry: 4etw (more details), 2.05 Å
SCOPe Domain Sequences for d4etwc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4etwc_ c.69.1.26 (C:) automated matches {Shigella flexneri [TaxId: 623]} niwwqtkgqgnvhlvllhgwglnaevwrcideelsshftlhlvdlpgfgrsrgfgalsla dmaeavlqqapdkaiwlgwalgglvasqialthpervqalvtvasspcfsardewpgikp dvlagfqqqlsddfqrtverflalqtmgtetarqdaralkktvlalpmpevdvlngglei lktvdlrqplqnvsmpflrlygyldglvprkvvpmldklwphsesyifakaahapfishp aefchllvalkqrvl
Timeline for d4etwc_: