Lineage for d4etwc_ (4etw C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901628Family c.69.1.26: Biotin biosynthesis protein BioH [82509] (2 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 2901639Protein automated matches [194519] (2 species)
    not a true protein
  7. 2901642Species Shigella flexneri [TaxId:623] [194520] (1 PDB entry)
  8. 2901644Domain d4etwc_: 4etw C: [194534]
    Other proteins in same PDB: d4etwb_, d4etwd_
    automated match to d1m33a_
    complexed with zmk

Details for d4etwc_

PDB Entry: 4etw (more details), 2.05 Å

PDB Description: structure of the enzyme-acp substrate gatekeeper complex required for biotin synthesis
PDB Compounds: (C:) Pimelyl-[acyl-carrier protein] methyl ester esterase

SCOPe Domain Sequences for d4etwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4etwc_ c.69.1.26 (C:) automated matches {Shigella flexneri [TaxId: 623]}
niwwqtkgqgnvhlvllhgwglnaevwrcideelsshftlhlvdlpgfgrsrgfgalsla
dmaeavlqqapdkaiwlgwalgglvasqialthpervqalvtvasspcfsardewpgikp
dvlagfqqqlsddfqrtverflalqtmgtetarqdaralkktvlalpmpevdvlngglei
lktvdlrqplqnvsmpflrlygyldglvprkvvpmldklwphsesyifakaahapfishp
aefchllvalkqrvl

SCOPe Domain Coordinates for d4etwc_:

Click to download the PDB-style file with coordinates for d4etwc_.
(The format of our PDB-style files is described here.)

Timeline for d4etwc_: