SCOPe 2.06: Domain d4a3ub_: 4a3u B:

Lineage for d4a3ub_ (4a3u B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (21 species)
   not a true protein

7. Species Zymomonas mobilis [TaxId:542] [194530] (1 PDB entry)

8. Domain d4a3ub_: 4a3u B: [194531]
   automated match to d3gkaa_
   complexed with act, fmn, k, na, nca

Details for d4a3ub_

PDB Entry: 4a3u, 1.7 Å

PDB Description: x-structure of the old yellow enzyme homologue from zymomonas mobilis (ncr)

PDB Compounds: (B:) NADH:flavin oxidoreductase/NADH oxidase

SCOPe Domain Sequences for d4a3ub_:

Sequence; same for both SEQRES and ATOM records:

>d4a3ub_ c.1.4.0 (B:) automated matches {Zymomonas mobilis [TaxId: 542]}
pslfdpirfgaftaknriwmapltrgratrdhvpteimaeyyaqrasagliiseatgisq
eglgwpyapgiwsdaqveawlpitqavhdagglifaqlwhmgrmvpsnvsgmqpvapsas
qapglghtydgkkpydvaralrldeiprllddyekaarhalkagfdgvqihaangylide
firdstnhrhdeyggavenrirllkdvterviatigkertavrlspngeiqgtvdshpeq
vfipaakmlsdldiaflgmregavdgtfgktdqpklspeirkvfkpplvlnqdytfetaq
aaldsgvadaisfgrpfignpdlprrffekapltkdvietwytqtpkgytdypll

Timeline for d4a3ub_:

• d4a3ub_ first appeared in SCOPe 2.02
  
• d4a3ub_ appears in SCOPe 2.05
  
• d4a3ub_ appears in SCOPe 2.07
  
• d4a3ub_ appears in the current release, SCOPe 2.08