Class a: All alpha proteins [46456] (286 folds) |
Fold a.129: GroEL equatorial domain-like [48591] (1 superfamily) multihelical; 8 helices arranged in 2 parallel layers |
Superfamily a.129.1: GroEL equatorial domain-like [48592] (2 families) duplication: two 4-helical subdomains are related by a pseudo dyad passing through the ATP-binding site |
Family a.129.1.1: GroEL chaperone, ATPase domain [48593] (1 protein) |
Protein GroEL, E domain [48594] (4 species) |
Species Escherichia coli [TaxId:562] [48595] (11 PDB entries) |
Domain d1oelb1: 1oel B:2-136,B:410-525 [19453] Other proteins in same PDB: d1oela2, d1oela3, d1oelb2, d1oelb3, d1oelc3, d1oelc4, d1oeld2, d1oeld3, d1oele2, d1oele3, d1oelf2, d1oelf3, d1oelg2, d1oelg3 |
PDB Entry: 1oel (more details), 2.8 Å
SCOPe Domain Sequences for d1oelb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oelb1 a.129.1.1 (B:2-136,B:410-525) GroEL, E domain {Escherichia coli [TaxId: 562]} aakdvkfgndagvkmlrgvnvladavkvtlgpkgrnvvldksfgaptitkdgvsvareie ledkfenmgaqmvkevaskandaagdgtttatvlaqaiiteglkavaagmnpmdlkrgid kavtvaveelkalsvXgvvagggvalirvaskladlrgqnedqnvgikvalrameaplrq ivlncgeepsvvantvkggdgnygynaateeygnmidmgildptkvtrsalqyaasvagl mittecmvtdlp
Timeline for d1oelb1: