Lineage for d4aqrb_ (4aqr B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710548Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. 2711203Protein automated matches [190064] (21 species)
    not a true protein
  7. 2711367Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [194524] (2 PDB entries)
  8. 2711369Domain d4aqrb_: 4aqr B: [194525]
    automated match to d1rfja_
    complexed with ca

Details for d4aqrb_

PDB Entry: 4aqr (more details), 1.95 Å

PDB Description: Crystal structure of calmodulin in complex with the regulatory domain of a plasma-membrane Ca2+-ATPase
PDB Compounds: (B:) calmodulin-7

SCOPe Domain Sequences for d4aqrb_:

Sequence, based on SEQRES records: (download)

>d4aqrb_ a.39.1.5 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dqltddqisefkeafslfdkdgdgcittkelgtvmrslgqnpteaelqdminevdadgng
tidfpeflnlmarkmkdtdseeelkeafrvfdkdqngfisaaelrhvmtnlgekltdeev
demireadvdgdgqinyeefvkvmma

Sequence, based on observed residues (ATOM records): (download)

>d4aqrb_ a.39.1.5 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dqltddqisefkeafslfdkdgdgcittkelgtvmrslgqnpteaelqdminevdadgng
tidfpeflnlmardseeelkeafrvfdkdqngfisaaelrhvmtnlgekltdeevdemir
eadvdgdgqinyeefvkvmma

SCOPe Domain Coordinates for d4aqrb_:

Click to download the PDB-style file with coordinates for d4aqrb_.
(The format of our PDB-style files is described here.)

Timeline for d4aqrb_: