Lineage for d4e89a_ (4e89 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860195Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1860196Protein automated matches [190396] (30 species)
    not a true protein
  7. 1860415Species Xenotropic mulv-related virus [TaxId:373193] [194522] (1 PDB entry)
  8. 1860416Domain d4e89a_: 4e89 A: [194523]
    automated match to d1jl2c_
    complexed with cd, mg

Details for d4e89a_

PDB Entry: 4e89 (more details), 2.6 Å

PDB Description: Crystal Structure of RnaseH from gammaretrovirus
PDB Compounds: (A:) RNase H

SCOPe Domain Sequences for d4e89a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e89a_ c.55.3.0 (A:) automated matches {Xenotropic mulv-related virus [TaxId: 373193]}
pdltdqpipdadytwytdgssflqegqrragaavtteteviwaralpagtsaqraelial
tqalkmaegkklnvytdsryafatahvhgeiyrrrglltsegreiknkneilallkalfl
pkrlsiihcpghqkgnsaeargnrmadqaareaamka

SCOPe Domain Coordinates for d4e89a_:

Click to download the PDB-style file with coordinates for d4e89a_.
(The format of our PDB-style files is described here.)

Timeline for d4e89a_: