Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) consists of one domain of this fold |
Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
Protein automated matches [190396] (30 species) not a true protein |
Species Xenotropic mulv-related virus [TaxId:373193] [194522] (1 PDB entry) |
Domain d4e89a_: 4e89 A: [194523] automated match to d1jl2c_ complexed with cd, mg |
PDB Entry: 4e89 (more details), 2.6 Å
SCOPe Domain Sequences for d4e89a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e89a_ c.55.3.0 (A:) automated matches {Xenotropic mulv-related virus [TaxId: 373193]} pdltdqpipdadytwytdgssflqegqrragaavtteteviwaralpagtsaqraelial tqalkmaegkklnvytdsryafatahvhgeiyrrrglltsegreiknkneilallkalfl pkrlsiihcpghqkgnsaeargnrmadqaareaamka
Timeline for d4e89a_: