Lineage for d4fdva_ (4fdv A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1160391Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) (S)
    fold elaborated with additional structures
  5. 1160392Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (3 proteins)
  6. 1160406Protein automated matches [190963] (2 species)
    not a true protein
  7. 1160412Species Rhodobacter capsulatus [TaxId:272942] [194508] (1 PDB entry)
  8. 1160413Domain d4fdva_: 4fdv A: [194509]
    automated match to d1f2va_
    complexed with 0uk, gol

Details for d4fdva_

PDB Entry: 4fdv (more details), 1.68 Å

PDB Description: CobH from Rhodobacter capsulatus (SB1003) in complex with HBA
PDB Compounds: (A:) precorrin-8x methylmutase

SCOPe Domain Sequences for d4fdva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fdva_ c.23.17.1 (A:) automated matches {Rhodobacter capsulatus [TaxId: 272942]}
pheyekdgakiyvqsfatiraeadlarftpeeevvvvrmihaagmvglenhvrfapgmai
aaraaleagapilcdarmvsegitrarlpaknevictlqdprvpalaqemgntrsaaale
lwrpklegavvaignaptalfhllnmledpacprpaaiigcpvgfigaaeskaalavanp
vpwvivegrlggsaitvaavnalacrke

SCOPe Domain Coordinates for d4fdva_:

Click to download the PDB-style file with coordinates for d4fdva_.
(The format of our PDB-style files is described here.)

Timeline for d4fdva_: