Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) fold elaborated with additional structures |
Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (3 proteins) |
Protein automated matches [190963] (2 species) not a true protein |
Species Rhodobacter capsulatus [TaxId:272942] [194508] (1 PDB entry) |
Domain d4fdva_: 4fdv A: [194509] automated match to d1f2va_ complexed with 0uk, gol |
PDB Entry: 4fdv (more details), 1.68 Å
SCOPe Domain Sequences for d4fdva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fdva_ c.23.17.1 (A:) automated matches {Rhodobacter capsulatus [TaxId: 272942]} pheyekdgakiyvqsfatiraeadlarftpeeevvvvrmihaagmvglenhvrfapgmai aaraaleagapilcdarmvsegitrarlpaknevictlqdprvpalaqemgntrsaaale lwrpklegavvaignaptalfhllnmledpacprpaaiigcpvgfigaaeskaalavanp vpwvivegrlggsaitvaavnalacrke
Timeline for d4fdva_: