![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.0: automated matches [191311] (1 protein) not a true family |
![]() | Protein automated matches [190052] (7 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (52 PDB entries) |
![]() | Domain d4gmxb_: 4gmx B: [194507] Other proteins in same PDB: d4gmxa_ automated match to d1k5db_ complexed with cl, edo, gnp, gol, k85, mg |
PDB Entry: 4gmx (more details), 2.1 Å
SCOPe Domain Sequences for d4gmxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gmxb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlkican hiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqei nkk
Timeline for d4gmxb_: