SCOPe 2.08: Domain d4gmxb_: 4gmx B:

Lineage for d4gmxb_ (4gmx B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (63 PDB entries)

8. Domain d4gmxb_: 4gmx B: [194507]
   Other proteins in same PDB: d4gmxa_
   automated match to d1k5db_
   complexed with cl, edo, gnp, gol, k85, mg

Details for d4gmxb_

PDB Entry: 4gmx, 2.1 Å

PDB Description: Crystal structure of KPT185 in complex with CRM1-Ran-RanBP1

PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d4gmxb_:

Sequence; same for both SEQRES and ATOM records:

>d4gmxb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tmeedeevlykvraklfrfdadakewkergtgdckflknkktnkvrilmrrdktlkican
hiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqei
nkk

Timeline for d4gmxb_:

• d4gmxb_ first appeared in SCOPe 2.02
  
• d4gmxb_ appears in SCOPe 2.07