SCOPe 2.02: Domain d2qc1b_: 2qc1 B:

Lineage for d2qc1b_ (2qc1 B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (2 species)
   not a true protein

7. Species Mus musculus [TaxId:10090] [194495] (1 PDB entry)

8. Domain d2qc1b_: 2qc1 B: [194496]
   Other proteins in same PDB: d2qc1a_
   automated match to d3sq6a_

Details for d2qc1b_

PDB Entry: 2qc1, 1.94 Å

PDB Description: crystal structure of the extracellular domain of the nicotinic acetylcholine receptor 1 subunit bound to alpha-bungarotoxin at 1.9 a resolution

PDB Compounds: (B:) Acetylcholine receptor subunit alpha

SCOPe Domain Sequences for d2qc1b_:

Sequence; same for both SEQRES and ATOM records:

>d2qc1b_ b.96.1.0 (B:) automated matches {Mus musculus [TaxId: 10090]}
ksehetrleaklfedyssvvrpvedhreivqvtvglqliqlinvdevnqivttnvrlkqq
wvdynlkwnpddyggvkkihipsekiwrpdvvlynnadgdfaivkftkvlldytghitwt
ppaifksyceiivthfpfdeqncsmklgtrtydgsavainpesdqpdlsnfmesgewvik
eargwkhwvfysccpttpyldityhfvmqrlp

Timeline for d2qc1b_:

• d2qc1b_ is new in SCOPe 2.02-stable
  
• d2qc1b_ appears in SCOPe 2.03
  
• d2qc1b_ appears in the current release, SCOPe 2.08, called d2qc1b1