![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
![]() | Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) ![]() |
![]() | Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
![]() | Protein automated matches [193506] (2 species) not a true protein |
![]() | Species Mus musculus [TaxId:10090] [194495] (1 PDB entry) |
![]() | Domain d2qc1b_: 2qc1 B: [194496] Other proteins in same PDB: d2qc1a_ automated match to d3sq6a_ |
PDB Entry: 2qc1 (more details), 1.94 Å
SCOPe Domain Sequences for d2qc1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qc1b_ b.96.1.0 (B:) automated matches {Mus musculus [TaxId: 10090]} ksehetrleaklfedyssvvrpvedhreivqvtvglqliqlinvdevnqivttnvrlkqq wvdynlkwnpddyggvkkihipsekiwrpdvvlynnadgdfaivkftkvlldytghitwt ppaifksyceiivthfpfdeqncsmklgtrtydgsavainpesdqpdlsnfmesgewvik eargwkhwvfysccpttpyldityhfvmqrlp
Timeline for d2qc1b_: