SCOPe 2.08: Domain d2qc1b1: 2qc1 B:1-211

Lineage for d2qc1b1 (2qc1 B:1-211)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [194495] (2 PDB entries)

8. Domain d2qc1b1: 2qc1 B:1-211 [194496]
   Other proteins in same PDB: d2qc1a_, d2qc1b2
   automated match to d3sq6a_

Details for d2qc1b1

PDB Entry: 2qc1, 1.94 Å

PDB Description: crystal structure of the extracellular domain of the nicotinic acetylcholine receptor 1 subunit bound to alpha-bungarotoxin at 1.9 a resolution

PDB Compounds: (B:) Acetylcholine receptor subunit alpha

SCOPe Domain Sequences for d2qc1b1:

Sequence; same for both SEQRES and ATOM records:

>d2qc1b1 b.96.1.0 (B:1-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sehetrleaklfedyssvvrpvedhreivqvtvglqliqlinvdevnqivttnvrlkqqw
vdynlkwnpddyggvkkihipsekiwrpdvvlynnadgdfaivkftkvlldytghitwtp
paifksyceiivthfpfdeqncsmklgtrtydgsavainpesdqpdlsnfmesgewvike
argwkhwvfysccpttpyldityhfvmqrlp

Timeline for d2qc1b1:

• d2qc1b1 first appeared in SCOPe 2.02, called d2qc1b_
  
• d2qc1b1 appears in SCOPe 2.07